Results for Ktqaqmfhttpshttpshttpshttps

Clock Camera 2K Wood Grain,5G&2.4G WiFi Indoor Security Camera,Cameras for Home Security,3 in 1 Indoor Camera with Alarm,Full Color Night Vision Human Motion Detection Local SD Storage
Free shipping

Clock Camera 2K Wood Grain,5G&2.4G WiFi Indoor Security Camera,Cameras for Home Security,3 in 1 Indoor Camera with Alarm,Full Color Night Vision Human Motion Detection Local SD Storage

5.011 sold
-43%$45.99$79.99
lucy hair 13x4 8 inch Human Human Hair Density With Natural Hairline Easy Install Drawstring Half Wigs For Beginners Protective Style #

lucy hair 13x4 8 inch Human Human Hair Density With Natural Hairline Easy Install Drawstring Half Wigs For Beginners Protective Style #

9 sold
$3.00
lucy hair 13x4 Wear and Go Glueless Pre Plucked Pre t Water Wave H Wig Density Glueless Lace Front For Women

lucy hair 13x4 Wear and Go Glueless Pre Plucked Pre t Water Wave H Wig Density Glueless Lace Front For Women

1.01 sold
$3.00
30 Inch 180 Density 360 Deep Wave Lace Front Wigs Human Hair Invisi Strap HD Full Lace Front Wigs Human Hair Pre Plucked With Drawstring Glueless Curly Human Hair Wig For Women Natural Color
Free shipping

30 Inch 180 Density 360 Deep Wave Lace Front Wigs Human Hair Invisi Strap HD Full Lace Front Wigs Human Hair Pre Plucked With Drawstring Glueless Curly Human Hair Wig For Women Natural Color

3.583 sold
-39%$65.88$108.00
Bling Hair Deep Wave 13x6 Lace Front Wigs Human Hair Pre Plucked 180% Density HD Transparent 13x4 Lace Frontal Wigs For Women Human Hair Lace Front Wigs Deep Curly Lace Front Wig #SummerVibes summerwins
Free shipping

Bling Hair Deep Wave 13x6 Lace Front Wigs Human Hair Pre Plucked 180% Density HD Transparent 13x4 Lace Frontal Wigs For Women Human Hair Lace Front Wigs Deep Curly Lace Front Wig #SummerVibes summerwins

4.55.0K sold
Limited time deal
-52%$80.00$167.98
Bling Hair 13x6 Deep Wave HD Lace Front Wig Human Hair 180% density Transparent Lace Frontal Wigs For Women Human Hair Hair Wigs Pre Plucked Lace Front Wig Real Hair Wigs summerwins
Free shipping

Bling Hair 13x6 Deep Wave HD Lace Front Wig Human Hair 180% density Transparent Lace Frontal Wigs For Women Human Hair Hair Wigs Pre Plucked Lace Front Wig Real Hair Wigs summerwins

4.524.6K sold
-59%$79.59$194.12
Short Curly Lace Wigs Human hair Pixie Wigs Natural black Human Hair Pixie Cut Lace Front Wigs Human Hair 13x1 Short Curly Wigs HD Glueless Pre Plucked Lace Front Wig For Black Women
Free shipping

Short Curly Lace Wigs Human hair Pixie Wigs Natural black Human Hair Pixie Cut Lace Front Wigs Human Hair 13x1 Short Curly Wigs HD Glueless Pre Plucked Lace Front Wig For Black Women

1 sold
$29.90
2026 Upgraded Straight Hair Comb, Portable Fashion Lazy Straightener, USB Rechargeable Flat Iron Clip, Wireless Straightening & Curling Comb
Free shipping

2026 Upgraded Straight Hair Comb, Portable Fashion Lazy Straightener, USB Rechargeable Flat Iron Clip, Wireless Straightening & Curling Comb

2.31.2K sold
Limited time deal
-55%$19.99$43.98
40 Inch Lace Front Wigs Human Hair Pre Plucked With Baby Hair 13x4 Straight HD Transparent Lace Front Wigs for Women 180 Density Glueless Natural Color
Free shipping

40 Inch Lace Front Wigs Human Hair Pre Plucked With Baby Hair 13x4 Straight HD Transparent Lace Front Wigs for Women 180 Density Glueless Natural Color

4.6107 sold
$54.90
AMZHAIR Grey Full Lace Frontal Wigs 100% Human Hair Straight Lace Front Wigs for Black Women 13x4 13x6 HD Lace Frontal Wig Pre Plucked Natural Hairline 180% Density Thick Silver Colored Grey Wigs
Free shipping

AMZHAIR Grey Full Lace Frontal Wigs 100% Human Hair Straight Lace Front Wigs for Black Women 13x4 13x6 HD Lace Frontal Wig Pre Plucked Natural Hairline 180% Density Thick Silver Colored Grey Wigs

4.258 sold
Limited time deal
$62.00
CORIIANA 250% 13x6 Lace Frontal Wig Human Hair Deep Wave Curly Glueless Wigs Human Hair For Black Women Pre Plucked Wet An Wavy HD Lace Front Wig 200% Density
Free shipping

CORIIANA 250% 13x6 Lace Frontal Wig Human Hair Deep Wave Curly Glueless Wigs Human Hair For Black Women Pre Plucked Wet An Wavy HD Lace Front Wig 200% Density

4.61.8K sold
$81.00
CORIIANA Deep Wave Glueless Wig Human Hair Ready To Wear Pre Plucked 7x5 Curly Wet And Wave 13x6 HD Lace Frontal Wigs For Black Women 200 250 Density
Free shipping

CORIIANA Deep Wave Glueless Wig Human Hair Ready To Wear Pre Plucked 7x5 Curly Wet And Wave 13x6 HD Lace Frontal Wigs For Black Women 200 250 Density

4.62.1K sold
$74.00
Fashionable Natural Super Soft 24-Inch 180% Density 13x4 Front Lace Wig, Super Curl Pre-Plucked Daily Use, Heat Resistant Curly Hair, Lace Front Wigs, HD Lace Wig

Fashionable Natural Super Soft 24-Inch 180% Density 13x4 Front Lace Wig, Super Curl Pre-Plucked Daily Use, Heat Resistant Curly Hair, Lace Front Wigs, HD Lace Wig

3 sold
$20.34
Bling Hair 180% Density Wear and Go Glueless Wig Human Hair Straight 6x4 Pre-Cut HD Lace Front Closure Wig for Women Pre-Plucked Transparent Lace Natural Look Easy Application Precut Lace Wig
Free shipping

Bling Hair 180% Density Wear and Go Glueless Wig Human Hair Straight 6x4 Pre-Cut HD Lace Front Closure Wig for Women Pre-Plucked Transparent Lace Natural Look Easy Application Precut Lace Wig

4.7183 sold
-39%$51.83$84.97
Burgundy Fashion Natural Ultra-Soft 26-Inch 180% Density 13x4x1 Front Lace Wig, Super Curl Pre-Pulled Daily Use, Heat Resistant, Lace Front Wigs, Fluffy Curly Wig, Pre Styled Wig

Burgundy Fashion Natural Ultra-Soft 26-Inch 180% Density 13x4x1 Front Lace Wig, Super Curl Pre-Pulled Daily Use, Heat Resistant, Lace Front Wigs, Fluffy Curly Wig, Pre Styled Wig

30 sold
-59%$21.40$52.19
41/60 Inch J-Shaped Pregnancy Pillow for Side Sleeping Full Body Support for Back Belly Hips & Legs Removable Washable Cover Soft Velvet Material

41/60 Inch J-Shaped Pregnancy Pillow for Side Sleeping Full Body Support for Back Belly Hips & Legs Removable Washable Cover Soft Velvet Material

4.74.4K sold
Flash sale00:00:00
$27.69
Anyweek Honey Blonde 360 Wig Human Hair Hidden Strap Drawstring Highlight Ombre Drawstring 360 Body Wave Lace Front Wigs Human Hair Pre Plucked 180 Density Glueless Wigs for Black Women Full Frontal Lace Wig 4/27 Colored
Free shipping

Anyweek Honey Blonde 360 Wig Human Hair Hidden Strap Drawstring Highlight Ombre Drawstring 360 Body Wave Lace Front Wigs Human Hair Pre Plucked 180 Density Glueless Wigs for Black Women Full Frontal Lace Wig 4/27 Colored

5.015 sold
$79.00
Highlight Blonde and Natural Color 13x6 Lace Frontal Human Hair Wig Black and 27 Colored 13x4 Transparent Lace Front Wig Pre Plucked For Women
Free shipping

Highlight Blonde and Natural Color 13x6 Lace Frontal Human Hair Wig Black and 27 Colored 13x4 Transparent Lace Front Wig Pre Plucked For Women

5.081 sold
-25%$87.35$116.47
[Live Only]Tuneful Ginger Brown 13x6 Body Wave Lace Front Wigs Human Hair Pre Plucked With Baby Hair 180 Density 4# Colored Brown Transparent HD Transparent Lace Frontal Wigs for Women
Free shipping

[Live Only]Tuneful Ginger Brown 13x6 Body Wave Lace Front Wigs Human Hair Pre Plucked With Baby Hair 180 Density 4# Colored Brown Transparent HD Transparent Lace Frontal Wigs for Women

2 sold
Limited time deal
$70.99
Straight Lace Front Human Hair Wigs 250% 13x6 HD Lace Frontal Wig Pre plucked Natural Hairline 100% Raw Human Hair Wigs
Free shipping

Straight Lace Front Human Hair Wigs 250% 13x6 HD Lace Frontal Wig Pre plucked Natural Hairline 100% Raw Human Hair Wigs

5.073 sold
-20%$96.56$120.70
J-Shaped Multi-Functional Pregnancy Pillow, Relieves Discomfort During Pregnancy, Full-Body Support, Nursing Pillow
Free shipping

J-Shaped Multi-Functional Pregnancy Pillow, Relieves Discomfort During Pregnancy, Full-Body Support, Nursing Pillow

3.7380 sold
Limited time deal
-48%$20.99$39.99
Zlzlblbl 13x6 Straight Lace Front Wigs Human Hair 200 Density HD Lace Frontal Human Hair Wigs for Women Glueless Wig Pre Plucked With Baby Hair
Free shipping

Zlzlblbl 13x6 Straight Lace Front Wigs Human Hair 200 Density HD Lace Frontal Human Hair Wigs for Women Glueless Wig Pre Plucked With Baby Hair

5.047 sold
-24%$98.96$129.96
Bling Hair 180 Density 13x6 Deep Wave Hd Transparent Lace Front Human Hair Wigs 36 38 Inch Brazilian 13X4 Lace Frontal Wig For Women Pre Plucked
Free shipping

Bling Hair 180 Density 13x6 Deep Wave Hd Transparent Lace Front Human Hair Wigs 36 38 Inch Brazilian 13X4 Lace Frontal Wig For Women Pre Plucked

4.64.0K sold
-39%$64.74$106.45
Glueless Curly Lace Front Human Hair Wig With Super Natural Hairline 360 13x6 Drawstring Wig Regular or 4C Curly Edges Hairline Option 220% Density Pre Bleached Knots #TikTokdealsforyoudays
Free shipping

Glueless Curly Lace Front Human Hair Wig With Super Natural Hairline 360 13x6 Drawstring Wig Regular or 4C Curly Edges Hairline Option 220% Density Pre Bleached Knots #TikTokdealsforyoudays

4.75.9K sold
-58%$105.84$252.00
36-40Inch 13X4 Ear to Ear Body Wave Lace Front Wigs Human Hair 200% HD Transparent Frontal Glueless Air Wigs Human Hair with Baby Hair for Women High Density Brazilian Virgin Human Hair Wig SHEIN

36-40Inch 13X4 Ear to Ear Body Wave Lace Front Wigs Human Hair 200% HD Transparent Frontal Glueless Air Wigs Human Hair with Baby Hair for Women High Density Brazilian Virgin Human Hair Wig SHEIN

36 sold
$25.61

Recommended for you

The Shower Filter - Chrome
Free shipping
Kitsch

The Shower Filter - Chrome

4.7752 sold
$50.00
COOFANDY Men's Mock Turtleneck Sweater Short Sleeve Casual Basic Tops Ribbed Knit Pullover Solid Tee
Free shipping
Coofandy

COOFANDY Men's Mock Turtleneck Sweater Short Sleeve Casual Basic Tops Ribbed Knit Pullover Solid Tee

4.716.8K sold
$37.99
Get Edikted Sweatshirt
Edikted

Get Edikted Sweatshirt

4.81.8K sold
$44.00
Cataleya Tank Top
Edikted

Cataleya Tank Top

3.6112 sold
$25.20
5 pc. Beef Jerky Sampler Pack - 1 oz. Sample Size Bags, 5 Flavor Variety Pack, High Protein Meat Snacks, Jerky Gift Set

5 pc. Beef Jerky Sampler Pack - 1 oz. Sample Size Bags, 5 Flavor Variety Pack, High Protein Meat Snacks, Jerky Gift Set

4.4812 sold
Flash sale00:00:00
$35.90
Related Searches
ktqaqmfhttpshttpshttpshttpshttps
ktqmfhttpshttpshttpshttps
ktaqmfhttpshttpshttpshttps
ktqaqmf httpshttpshttpshttps
Related Categories
Security Cameras & Systems
Human Hair Full Machine Wigs
Synthetic Lace Front Wigs
Human Hair 360 Lace Wigs
Human Hair Lace Front Wigs
Curlers & Straighteners
Pillows & Bed Wedges
Human Hair Full Lace Wigs
Human Hair T Part Lace Wigs
Human Hair Lace Closure Wigs