Results for ktaaqtaqmfhttpshttpshttpshttps

USED-Tethered Spirits: Wiaqtaqne'wasultijik na Kjijaqmijinaq by Hoebers, Corinne (Paperback)
Free shipping

USED-Tethered Spirits: Wiaqtaqne'wasultijik na Kjijaqmijinaq by Hoebers, Corinne (Paperback)

$20.78
USED-Next Door Savior: Near Enough to Touch, Strong Enough to Trust by Max Lucado (Hardcover)
Free shipping

USED-Next Door Savior: Near Enough to Touch, Strong Enough to Trust by Max Lucado (Hardcover)

$5.09
USED Book - The Tuttle Twins and the Messed Up Market by Connor Boyack (Paperback) - english
Free shipping

USED Book - The Tuttle Twins and the Messed Up Market by Connor Boyack (Paperback) - english

$4.91
USED-The Emma Smith We Know by Darcy Kennedy (Paperback)
Free shipping

USED-The Emma Smith We Know by Darcy Kennedy (Paperback)

$6.44
[Combo sale 30"&30"] buy 1 get 2 wig" 22 Inch13x4 Body Wave Hair Lace Front Wigs + 13x4 22Inch Body wave 4/27 Human Hair Hair PrePlucked HD Transparent Lace Frontal HumanHair Wigs 180% Density
Free shipping

[Combo sale 30"&30"] buy 1 get 2 wig" 22 Inch13x4 Body Wave Hair Lace Front Wigs + 13x4 22Inch Body wave 4/27 Human Hair Hair PrePlucked HD Transparent Lace Frontal HumanHair Wigs 180% Density

12 sold
Limited time deal
$95.99
Double-Sided Deshedding Grooming Brush - Undercoat Rake, Dematting Tool, Grooming Accessories, Non-Scratch Shedding Tools, 90% Reduction, Skin-Gentle Metal Comb for Dogs & Cats with Short/Long Hair
Free shipping

Double-Sided Deshedding Grooming Brush - Undercoat Rake, Dematting Tool, Grooming Accessories, Non-Scratch Shedding Tools, 90% Reduction, Skin-Gentle Metal Comb for Dogs & Cats with Short/Long Hair

5.0139 sold
Limited time deal
$14.40
lucy hair 13x4 8 inch Human Human Hair Density With Natural Hairline Easy Install Drawstring Half Wigs For Beginners Protective Style #

lucy hair 13x4 8 inch Human Human Hair Density With Natural Hairline Easy Install Drawstring Half Wigs For Beginners Protective Style #

9 sold
$3.00
Burgundy Fashion Natural Ultra-Soft 26-Inch 180% Density 13x4x1 Front Lace Wig, Super Curl Pre-Pulled Daily Use, Heat Resistant, Lace Front Wigs, Fluffy Curly Wig, Pre Styled Wig

Burgundy Fashion Natural Ultra-Soft 26-Inch 180% Density 13x4x1 Front Lace Wig, Super Curl Pre-Pulled Daily Use, Heat Resistant, Lace Front Wigs, Fluffy Curly Wig, Pre Styled Wig

28 sold
-59%$21.40$52.19
Short Curly Lace Wigs Human hair Pixie Wigs Natural black Human Hair Pixie Cut Lace Front Wigs Human Hair 13x1 Short Curly Wigs HD Glueless Pre Plucked Lace Front Wig For Black Women
Free shipping

Short Curly Lace Wigs Human hair Pixie Wigs Natural black Human Hair Pixie Cut Lace Front Wigs Human Hair 13x1 Short Curly Wigs HD Glueless Pre Plucked Lace Front Wig For Black Women

1 sold
$29.90
fathers day gifts, +2.50 Diopter Progressive Multifocal Reading Glasses, Fits +2.25 to +2.75, Photochromic Semi-Rimless Blue Light Readers for Men Women
Free shipping

fathers day gifts, +2.50 Diopter Progressive Multifocal Reading Glasses, Fits +2.25 to +2.75, Photochromic Semi-Rimless Blue Light Readers for Men Women

18 sold
-31%$23.99$34.99
30 Inch Deep Wave Lace Front Wigs Human Hair 13x6 HD Transparent Deep Curly Lace Frontal Wigs 180% Density Glueless Wigs Human Hair pre Plucked with Baby Hair Natural Color Honey Blonde 4/27 99j Burgundy
Free shipping

30 Inch Deep Wave Lace Front Wigs Human Hair 13x6 HD Transparent Deep Curly Lace Frontal Wigs 180% Density Glueless Wigs Human Hair pre Plucked with Baby Hair Natural Color Honey Blonde 4/27 99j Burgundy

5.016 sold
Limited time deal
-40%$58.80$98.00
Bling Hair 32 34 36 Long Size 13×6 Loose Deep Wave Lace Frontal Wigs Pre Plucked 13X4 Lace Front Wigs Human Hair For Black Women
Free shipping

Bling Hair 32 34 36 Long Size 13×6 Loose Deep Wave Lace Frontal Wigs Pre Plucked 13X4 Lace Front Wigs Human Hair For Black Women

4.4411 sold
-48%$76.74$147.74
2026 Upgraded Straight Hair Comb, Portable Fashion Lazy Straightener, USB Rechargeable Flat Iron Clip, Wireless Straightening & Curling Comb
Free shipping

2026 Upgraded Straight Hair Comb, Portable Fashion Lazy Straightener, USB Rechargeable Flat Iron Clip, Wireless Straightening & Curling Comb

2.31.1K sold
Limited time deal
-55%$19.99$43.98
40 Inch Lace Front Wigs Human Hair Pre Plucked With Baby Hair 13x4 Straight HD Transparent Lace Front Wigs for Women 180 Density Glueless Natural Color
Free shipping

40 Inch Lace Front Wigs Human Hair Pre Plucked With Baby Hair 13x4 Straight HD Transparent Lace Front Wigs for Women 180 Density Glueless Natural Color

4.6107 sold
$54.90
26 inches long, 180 density, pre-comb free, 13x4 black curly hair, pre-combed for baby hair, comfortable to wear daily, heat-resistant, breathable, Curly Wig

26 inches long, 180 density, pre-comb free, 13x4 black curly hair, pre-combed for baby hair, comfortable to wear daily, heat-resistant, breathable, Curly Wig

9 sold
-35%$39.26$60.39
Bling Hair 13x6 Deep Wave HD Lace Front Wig Human Hair 180% density Transparent Lace Frontal Wigs For Women Human Hair Hair Wigs Pre Plucked Lace Front Wig Real Hair Wigs summerwins
Free shipping

Bling Hair 13x6 Deep Wave HD Lace Front Wig Human Hair 180% density Transparent Lace Frontal Wigs For Women Human Hair Hair Wigs Pre Plucked Lace Front Wig Real Hair Wigs summerwins

4.524.6K sold
-59%$79.59$194.12
Bling Hair 13x6 Bone Straight Transparent Lace Front Human Hair Wigs For Black Women 13x4 Lace Frontal Wig Natural Wigs Indian Hair Wigs 180Density #Summervibes
Free shipping

Bling Hair 13x6 Bone Straight Transparent Lace Front Human Hair Wigs For Black Women 13x4 Lace Frontal Wig Natural Wigs Indian Hair Wigs 180Density #Summervibes

4.79.3K sold
Flash sale
$64.91
30 Inch 13x6 Body Wave Lace Front Wigs Human Hair Pre Plucked 180% Density HD Lace Frontal Wigs Human Hair For Women 10A Body Wave Glueless Wigs
Free shipping

30 Inch 13x6 Body Wave Lace Front Wigs Human Hair Pre Plucked 180% Density HD Lace Frontal Wigs Human Hair For Women 10A Body Wave Glueless Wigs

4.31.6K sold
-39%$57.95$95.00
SUKI ORIGINAL Free Part Short Bob 4x6 HD Lace Silky Straight Wig 180% Natural Black Deep Part Lace Glueless Human Hair Pre Plucked with Natural Hairline
Free shipping

SUKI ORIGINAL Free Part Short Bob 4x6 HD Lace Silky Straight Wig 180% Natural Black Deep Part Lace Glueless Human Hair Pre Plucked with Natural Hairline

4.53.0K sold
-35%$51.35$79.00
Highlight Blonde and Natural Color 13x6 Lace Frontal Human Hair Wig Black and 27 Colored 13x4 Transparent Lace Front Wig Pre Plucked For Women
Free shipping

Highlight Blonde and Natural Color 13x6 Lace Frontal Human Hair Wig Black and 27 Colored 13x4 Transparent Lace Front Wig Pre Plucked For Women

5.081 sold
-25%$87.35$116.47
Bling Hair 180% Density Wear and Go Glueless Wig Human Hair Straight 6x4 Pre-Cut HD Lace Front Closure Wig for Women Pre-Plucked Transparent Lace Natural Look Easy Application Precut Lace Wig
Free shipping

Bling Hair 180% Density Wear and Go Glueless Wig Human Hair Straight 6x4 Pre-Cut HD Lace Front Closure Wig for Women Pre-Plucked Transparent Lace Natural Look Easy Application Precut Lace Wig

4.7183 sold
-39%$51.83$84.97
Anyweek Honey Blonde 360 Wig Human Hair Hidden Strap Drawstring Highlight Ombre Drawstring 360 Body Wave Lace Front Wigs Human Hair Pre Plucked 180 Density Glueless Wigs for Black Women Full Frontal Lace Wig 4/27 Colored
Free shipping

Anyweek Honey Blonde 360 Wig Human Hair Hidden Strap Drawstring Highlight Ombre Drawstring 360 Body Wave Lace Front Wigs Human Hair Pre Plucked 180 Density Glueless Wigs for Black Women Full Frontal Lace Wig 4/27 Colored

5.015 sold
$79.00
13X6 Lace Front Wigs Human Hair Pre Plucked Body Wave #427 Ombre HD Lace Wigs Brazilian Virgin Human Hair 180% Density Tiny Knots Natural Hairline with Baby Hair for Women Honey Blonde 13X6 Lace Front Wig Body Wave Human Hair Fashionable
Free shipping

13X6 Lace Front Wigs Human Hair Pre Plucked Body Wave #427 Ombre HD Lace Wigs Brazilian Virgin Human Hair 180% Density Tiny Knots Natural Hairline with Baby Hair for Women Honey Blonde 13X6 Lace Front Wig Body Wave Human Hair Fashionable

4.4817 sold
-39%$34.77$57.00
Deep Wave Lace Front Wigs Human Hair 13x6 HD Lace Front Wigs Pre Plucked Brazilian Curly Human Hair Wig 180 Density Glueless Frontal Wigs For Women
Free shipping

Deep Wave Lace Front Wigs Human Hair 13x6 HD Lace Front Wigs Pre Plucked Brazilian Curly Human Hair Wig 180 Density Glueless Frontal Wigs For Women

2 sold
Limited time deal
-39%$35.38$58.00
Fashionable Natural Super Soft 24-Inch 180% Density 13x4 Front Lace Wig, Super Curl Pre-Plucked Daily Use, Heat Resistant Curly Hair, Lace Front Wigs, HD Lace Wig

Fashionable Natural Super Soft 24-Inch 180% Density 13x4 Front Lace Wig, Super Curl Pre-Plucked Daily Use, Heat Resistant Curly Hair, Lace Front Wigs, HD Lace Wig

3 sold
$20.34

Recommended for you

COOFANDY Men's Mock Turtleneck Sweater Short Sleeve Casual Basic Tops Ribbed Knit Pullover Solid Tee
Free shipping
Coofandy

COOFANDY Men's Mock Turtleneck Sweater Short Sleeve Casual Basic Tops Ribbed Knit Pullover Solid Tee

4.716.8K sold
$37.99
Lacey Knit Tank Top
Edikted

Lacey Knit Tank Top

4.62.2K sold
$19.20
Get Edikted Sweatshirt
Edikted

Get Edikted Sweatshirt

4.81.8K sold
$44.00
5 pc. Beef Jerky Sampler Pack - 1 oz. Sample Size Bags, 5 Flavor Variety Pack, High Protein Meat Snacks, Jerky Gift Set

5 pc. Beef Jerky Sampler Pack - 1 oz. Sample Size Bags, 5 Flavor Variety Pack, High Protein Meat Snacks, Jerky Gift Set

4.4812 sold
Flash sale
$35.90
Bead & Sequin Chiffon Tank Top
Edikted

Bead & Sequin Chiffon Tank Top

5.031 sold
$47.60
Related Searches
KTAQQTAQMFhttpshttpshttpshttps
KTAQQAQMFhttpshttpshttpshttps
KTAQTAQMFhttpshttpshttpshttps
KTA QQQMFhttpshttpshttpshttps
Related Categories
Literature
Religion & Philosophy
Parenting & Family
Human Hair Lace Front Wigs
Combs & Brushes
Human Hair Full Machine Wigs
Synthetic Lace Front Wigs
Reading Glasses
Curlers & Straighteners
Human Hair Lace Closure Wigs